Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 479851..480488 | Replicon | chromosome |
Accession | NZ_CP107079 | ||
Organism | Bacillus velezensis strain LT-2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OD347_RS02465 | Protein ID | WP_003156187.1 |
Coordinates | 480138..480488 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | OD347_RS02460 | Protein ID | WP_003156188.1 |
Coordinates | 479851..480132 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OD347_RS02440 | 476217..476816 | - | 600 | WP_088612192.1 | rhomboid family intramembrane serine protease | - |
OD347_RS02445 | 476909..477274 | + | 366 | WP_088612193.1 | holo-ACP synthase | - |
OD347_RS02450 | 477439..478446 | + | 1008 | WP_013351094.1 | outer membrane lipoprotein carrier protein LolA | - |
OD347_RS02455 | 478563..479732 | + | 1170 | WP_065521859.1 | alanine racemase | - |
OD347_RS02460 | 479851..480132 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OD347_RS02465 | 480138..480488 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OD347_RS02470 | 480609..481430 | + | 822 | WP_045508380.1 | STAS domain-containing protein | - |
OD347_RS02475 | 481435..481800 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
OD347_RS02480 | 481803..482203 | + | 401 | Protein_450 | anti-sigma regulatory factor | - |
OD347_RS02485 | 482215..483222 | + | 1008 | WP_013351098.1 | PP2C family protein-serine/threonine phosphatase | - |
OD347_RS02490 | 483286..483615 | + | 330 | WP_014469786.1 | anti-sigma factor antagonist | - |
OD347_RS02495 | 483612..484094 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
OD347_RS02500 | 484060..484848 | + | 789 | WP_013351101.1 | RNA polymerase sigma factor SigB | - |
OD347_RS02505 | 484848..485450 | + | 603 | WP_045508359.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T260518 WP_003156187.1 NZ_CP107079:480138-480488 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|