Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 9557..10200 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107078 | ||
| Organism | Kosakonia cowanii strain LT-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | ODS25_RS22025 | Protein ID | WP_263754817.1 |
| Coordinates | 9784..10200 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | ODS25_RS22020 | Protein ID | WP_200581138.1 |
| Coordinates | 9557..9787 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODS25_RS21990 | 5231..5581 | - | 351 | WP_263754812.1 | hypothetical protein | - |
| ODS25_RS21995 | 5656..5916 | - | 261 | WP_263754813.1 | hypothetical protein | - |
| ODS25_RS22000 | 6119..6631 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| ODS25_RS22005 | 6665..7798 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| ODS25_RS22010 | 7965..8738 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| ODS25_RS22015 | 8751..9251 | - | 501 | WP_263754815.1 | HEPN family nuclease | - |
| ODS25_RS22020 | 9557..9787 | + | 231 | WP_200581138.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| ODS25_RS22025 | 9784..10200 | + | 417 | WP_263754817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ODS25_RS22030 | 10356..11336 | + | 981 | WP_263754819.1 | hypothetical protein | - |
| ODS25_RS22035 | 11548..13119 | - | 1572 | WP_263754821.1 | AAA family ATPase | - |
| ODS25_RS22040 | 13306..13494 | - | 189 | WP_263754822.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..80130 | 80130 | |
| - | flank | IS/Tn | - | - | 13597..15396 | 1799 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15260.60 Da Isoelectric Point: 6.2251
>T260517 WP_263754817.1 NZ_CP107078:9784-10200 [Kosakonia cowanii]
VNKTYMLDTCICSFIMREQPEAVLKRLEQEVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVEEFCARLDAVLPWDRC
AVDATTEIRVALRLAGTPIGPNDTAIAGHAIATGAVLVTNNVREFERVPGLTLEDWVN
VNKTYMLDTCICSFIMREQPEAVLKRLEQEVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVEEFCARLDAVLPWDRC
AVDATTEIRVALRLAGTPIGPNDTAIAGHAIATGAVLVTNNVREFERVPGLTLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|