Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4612151..4612764 | Replicon | chromosome |
Accession | NZ_CP107077 | ||
Organism | Kosakonia cowanii strain LT-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ODS25_RS21600 | Protein ID | WP_242389198.1 |
Coordinates | 4612151..4612519 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ODS25_RS21605 | Protein ID | WP_042712315.1 |
Coordinates | 4612522..4612764 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODS25_RS21585 | 4609652..4610554 | + | 903 | WP_023479333.1 | formate dehydrogenase subunit beta | - |
ODS25_RS21590 | 4610551..4611189 | + | 639 | WP_263753594.1 | formate dehydrogenase cytochrome b556 subunit | - |
ODS25_RS21595 | 4611186..4612115 | + | 930 | WP_023479362.1 | formate dehydrogenase accessory protein FdhE | - |
ODS25_RS21600 | 4612151..4612519 | - | 369 | WP_242389198.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ODS25_RS21605 | 4612522..4612764 | - | 243 | WP_042712315.1 | CopG family transcriptional regulator | Antitoxin |
ODS25_RS21610 | 4612966..4613877 | + | 912 | WP_263753595.1 | alpha/beta hydrolase | - |
ODS25_RS21615 | 4613931..4614872 | - | 942 | WP_023479318.1 | fatty acid biosynthesis protein FabY | - |
ODS25_RS21620 | 4614917..4615351 | - | 435 | WP_023479361.1 | D-aminoacyl-tRNA deacylase | - |
ODS25_RS21625 | 4615348..4616220 | - | 873 | WP_263753596.1 | virulence factor BrkB family protein | - |
ODS25_RS21630 | 4616217..4616813 | - | 597 | WP_263753597.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.72 Da Isoelectric Point: 4.8667
>T260516 WP_242389198.1 NZ_CP107077:c4612519-4612151 [Kosakonia cowanii]
MSNLALFDTNILIDLFNGREEAANTFEDYNGRIAISLISWIEVLVGAKKVGQENATRDFLDSLEVIEISHPIAERSIELR
QAYRMKLPDAIILATAQIHSRCLVTRNIKDFASVTGVFTPYQ
MSNLALFDTNILIDLFNGREEAANTFEDYNGRIAISLISWIEVLVGAKKVGQENATRDFLDSLEVIEISHPIAERSIELR
QAYRMKLPDAIILATAQIHSRCLVTRNIKDFASVTGVFTPYQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|