Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4380160..4380745 | Replicon | chromosome |
Accession | NZ_CP107077 | ||
Organism | Kosakonia cowanii strain LT-1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | ODS25_RS20510 | Protein ID | WP_128483861.1 |
Coordinates | 4380160..4380450 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | ODS25_RS20515 | Protein ID | WP_042712602.1 |
Coordinates | 4380467..4380745 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODS25_RS20480 | 4375180..4376766 | + | 1587 | WP_200134477.1 | RNA repair transcriptional activator RtcR | - |
ODS25_RS20485 | 4376916..4377857 | + | 942 | WP_128483859.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
ODS25_RS20490 | 4377911..4378249 | - | 339 | WP_042712607.1 | XRE family transcriptional regulator | - |
ODS25_RS20495 | 4378236..4378601 | - | 366 | WP_263753505.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ODS25_RS20500 | 4378777..4379049 | + | 273 | WP_042712605.1 | DUF3811 domain-containing protein | - |
ODS25_RS20505 | 4379050..4379919 | - | 870 | WP_094419107.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
ODS25_RS20510 | 4380160..4380450 | + | 291 | WP_128483861.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ODS25_RS20515 | 4380467..4380745 | + | 279 | WP_042712602.1 | putative addiction module antidote protein | Antitoxin |
ODS25_RS20520 | 4380774..4382405 | - | 1632 | WP_124970715.1 | Na/Pi cotransporter family protein | - |
ODS25_RS20525 | 4382577..4383005 | - | 429 | WP_263753506.1 | hypothetical protein | - |
ODS25_RS20530 | 4383028..4383804 | - | 777 | WP_094419106.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10719.56 Da Isoelectric Point: 9.9480
>T260515 WP_128483861.1 NZ_CP107077:4380160-4380450 [Kosakonia cowanii]
MKEIVQTDAFKLWESSLRDAKLRAIISARLFRLANGLTGDVKPVGEGISELRIHYGAGYRIYFQLRGNTVVVLLCGGDKS
TQPKDIIYAKYLAKCV
MKEIVQTDAFKLWESSLRDAKLRAIISARLFRLANGLTGDVKPVGEGISELRIHYGAGYRIYFQLRGNTVVVLLCGGDKS
TQPKDIIYAKYLAKCV
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|