Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4126940..4127456 | Replicon | chromosome |
Accession | NZ_CP107077 | ||
Organism | Kosakonia cowanii strain LT-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ODS25_RS19365 | Protein ID | WP_042714048.1 |
Coordinates | 4126940..4127224 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ODS25_RS19370 | Protein ID | WP_042714051.1 |
Coordinates | 4127214..4127456 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODS25_RS19350 | 4122811..4123755 | + | 945 | WP_263753380.1 | trehalose operon repressor TreR | - |
ODS25_RS19355 | 4124103..4126238 | + | 2136 | WP_263753381.1 | anaerobic ribonucleoside-triphosphate reductase | - |
ODS25_RS19360 | 4126470..4126934 | + | 465 | WP_094422771.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
ODS25_RS19365 | 4126940..4127224 | - | 285 | WP_042714048.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ODS25_RS19370 | 4127214..4127456 | - | 243 | WP_042714051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ODS25_RS19375 | 4127535..4129445 | - | 1911 | WP_263753385.1 | BglG family transcription antiterminator | - |
ODS25_RS19380 | 4129526..4130263 | - | 738 | WP_263753386.1 | KDGP aldolase family protein | - |
ODS25_RS19385 | 4130260..4131378 | - | 1119 | WP_128483769.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10923.95 Da Isoelectric Point: 10.5826
>T260514 WP_042714048.1 NZ_CP107077:c4127224-4126940 [Kosakonia cowanii]
MIYELVFDPRALKEWKKLGVTVQAQFKKKLAEVLVQPRVEKARLHGLPDCYKIKLRASGYRLIYQVRDNVVTVFVVAIGK
REKEAAYHSATHRL
MIYELVFDPRALKEWKKLGVTVQAQFKKKLAEVLVQPRVEKARLHGLPDCYKIKLRASGYRLIYQVRDNVVTVFVVAIGK
REKEAAYHSATHRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|