Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3472531..3473147 Replicon chromosome
Accession NZ_CP107077
Organism Kosakonia cowanii strain LT-1

Toxin (Protein)


Gene name Hha Uniprot ID A0A807LE76
Locus tag ODS25_RS16350 Protein ID WP_023478287.1
Coordinates 3472929..3473147 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID -
Locus tag ODS25_RS16345 Protein ID WP_023478264.1
Coordinates 3472531..3472905 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ODS25_RS16335 3467629..3468828 + 1200 WP_042714476.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
ODS25_RS16340 3468851..3472000 + 3150 WP_263753081.1 multidrug efflux RND transporter permease subunit AcrB -
ODS25_RS16345 3472531..3472905 + 375 WP_023478264.1 Hha toxicity modulator TomB Antitoxin
ODS25_RS16350 3472929..3473147 + 219 WP_023478287.1 HHA domain-containing protein Toxin
ODS25_RS16355 3473223..3473789 + 567 WP_263753082.1 maltose O-acetyltransferase -
ODS25_RS16360 3473893..3474396 + 504 WP_042714469.1 YlaC family protein -
ODS25_RS16365 3474517..3475218 + 702 WP_263753083.1 GNAT family protein -
ODS25_RS16370 3475215..3475355 - 141 WP_023478279.1 type B 50S ribosomal protein L36 -
ODS25_RS16375 3475359..3475619 - 261 WP_023478283.1 type B 50S ribosomal protein L31 -
ODS25_RS16380 3475881..3476909 + 1029 WP_263753084.1 isopenicillin N synthase family oxygenase -
ODS25_RS16385 3476932..3477738 + 807 WP_042712879.1 MetQ/NlpA family ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8657.04 Da        Isoelectric Point: 7.9892

>T260513 WP_023478287.1 NZ_CP107077:3472929-3473147 [Kosakonia cowanii]
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELTDDELTVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14420.22 Da        Isoelectric Point: 6.0581

>AT260513 WP_023478264.1 NZ_CP107077:3472531-3472905 [Kosakonia cowanii]
MDEYSPKRHDIAQLKFLCESLHQECLANLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKHDKDNKLIELIDEYL
DDTFMLFSSYGINTHDLQKWRKTGGKLFRSFDNVSKANPVSHSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A807LE76

Antitoxin

Source ID Structure

References