Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 807795..808458 | Replicon | chromosome |
Accession | NZ_CP107077 | ||
Organism | Kosakonia cowanii strain LT-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | ODS25_RS03765 | Protein ID | WP_042718300.1 |
Coordinates | 808042..808458 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A807LAC0 |
Locus tag | ODS25_RS03760 | Protein ID | WP_023480982.1 |
Coordinates | 807795..808061 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODS25_RS03740 | 803351..804784 | - | 1434 | WP_124967325.1 | 6-phospho-beta-glucosidase | - |
ODS25_RS03745 | 804902..805630 | - | 729 | WP_263754676.1 | MurR/RpiR family transcriptional regulator | - |
ODS25_RS03750 | 805858..806517 | + | 660 | WP_263753980.1 | hemolysin III family protein | - |
ODS25_RS03755 | 806568..807548 | - | 981 | WP_200134952.1 | tRNA-modifying protein YgfZ | - |
ODS25_RS03760 | 807795..808061 | + | 267 | WP_023480982.1 | FAD assembly factor SdhE | Antitoxin |
ODS25_RS03765 | 808042..808458 | + | 417 | WP_042718300.1 | protein YgfX | Toxin |
ODS25_RS03770 | 808476..808997 | - | 522 | WP_094422004.1 | flavodoxin FldB | - |
ODS25_RS03775 | 809097..809993 | + | 897 | WP_263753982.1 | site-specific tyrosine recombinase XerD | - |
ODS25_RS03780 | 810018..810728 | + | 711 | WP_042718296.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ODS25_RS03785 | 810734..812467 | + | 1734 | WP_200134954.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16436.32 Da Isoelectric Point: 10.7346
>T260508 WP_042718300.1 NZ_CP107077:808042-808458 [Kosakonia cowanii]
VVLWQSELRVSWRAQWLSLLLHGFVAALILLMPWPLSYTPVWLLLLSLVVFDSVRSQRRINACHGEIKLLMDSRLRWQGE
EWDIVGTPWMLRSGMILRLRREEDGRRQHLWLASDSMDAQEWRDLRRMILQKPAQGLH
VVLWQSELRVSWRAQWLSLLLHGFVAALILLMPWPLSYTPVWLLLLSLVVFDSVRSQRRINACHGEIKLLMDSRLRWQGE
EWDIVGTPWMLRSGMILRLRREEDGRRQHLWLASDSMDAQEWRDLRRMILQKPAQGLH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|