Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 6078909..6079951 | Replicon | chromosome |
Accession | NZ_CP107064 | ||
Organism | Pseudomonas aeruginosa strain PALA20 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA20_RS28590 | Protein ID | WP_003153636.1 |
Coordinates | 6078909..6079484 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA20_RS28595 | Protein ID | WP_003050245.1 |
Coordinates | 6079481..6079951 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA20_RS28565 (PALA20_05646) | 6075347..6076072 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
PALA20_RS28570 (PALA20_05647) | 6076111..6077013 | - | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
PALA20_RS28575 (PALA20_05648) | 6077013..6077513 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA20_RS28580 (PALA20_05649) | 6077510..6077980 | - | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA20_RS28585 (PALA20_05650) | 6077977..6078891 | - | 915 | WP_003050256.1 | AAA family ATPase | - |
PALA20_RS28590 (PALA20_05651) | 6078909..6079484 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA20_RS28595 (PALA20_05652) | 6079481..6079951 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA20_RS28600 (PALA20_05653) | 6080155..6080538 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA20_RS28605 (PALA20_05654) | 6080535..6080768 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA20_RS28610 (PALA20_05655) | 6080785..6081144 | + | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA20_RS28615 (PALA20_05656) | 6081157..6081555 | + | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA20_RS28620 (PALA20_05657) | 6081552..6082244 | + | 693 | WP_023100424.1 | TIGR03746 family integrating conjugative element protein | - |
PALA20_RS28625 (PALA20_05658) | 6082241..6083152 | + | 912 | WP_269973235.1 | TIGR03749 family integrating conjugative element protein | - |
PALA20_RS28630 (PALA20_05659) | 6083142..6084560 | + | 1419 | WP_023100422.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 6037524..6165828 | 128304 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T260503 WP_003153636.1 NZ_CP107064:c6079484-6078909 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT260503 WP_003050245.1 NZ_CP107064:c6079951-6079481 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|