Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1414967..1415472 | Replicon | chromosome |
Accession | NZ_CP107064 | ||
Organism | Pseudomonas aeruginosa strain PALA20 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA20_RS06750 | Protein ID | WP_003083773.1 |
Coordinates | 1415191..1415472 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA20_RS06745 | Protein ID | WP_003083775.1 |
Coordinates | 1414967..1415194 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA20_RS06720 (PALA20_01336) | 1409985..1411478 | + | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
PALA20_RS06725 (PALA20_01337) | 1411647..1413074 | + | 1428 | WP_003083784.1 | GABA permease | - |
PALA20_RS06730 (PALA20_01338) | 1413156..1413497 | - | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
PALA20_RS06735 (PALA20_01339) | 1413570..1414070 | - | 501 | WP_003083778.1 | LEA type 2 family protein | - |
PALA20_RS06740 (PALA20_01340) | 1414171..1414791 | + | 621 | WP_003101226.1 | hypothetical protein | - |
PALA20_RS06745 (PALA20_01341) | 1414967..1415194 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA20_RS06750 (PALA20_01342) | 1415191..1415472 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA20_RS06755 (PALA20_01343) | 1415772..1416680 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA20_RS06760 (PALA20_01344) | 1416712..1417122 | - | 411 | WP_003110659.1 | aegerolysin family protein | - |
PALA20_RS06765 (PALA20_01345) | 1417302..1418036 | - | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
PALA20_RS06770 (PALA20_01346) | 1418137..1418823 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA20_RS06775 (PALA20_01347) | 1418872..1420221 | - | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T260499 WP_003083773.1 NZ_CP107064:1415191-1415472 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|