Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 16874..17466 Replicon plasmid pMJ4-4-MCR
Accession NZ_CP107047
Organism Klebsiella pneumoniae strain KPTA-2108

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag OEC00_RS27900 Protein ID WP_000520549.1
Coordinates 17218..17466 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag OEC00_RS27895 Protein ID WP_000681613.1
Coordinates 16874..17221 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEC00_RS27865 (OEC00_27865) 12879..13205 - 327 WP_000008647.1 TrbC/VirB2 family protein -
OEC00_RS27870 (OEC00_27870) 13219..13839 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
OEC00_RS27875 (OEC00_27875) 14195..14410 - 216 WP_000760375.1 EexN family lipoprotein -
OEC00_RS27880 (OEC00_27880) 14407..14700 - 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
OEC00_RS27885 (OEC00_27885) 14777..16006 - 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
OEC00_RS27890 (OEC00_27890) 16010..16513 - 504 WP_000781813.1 relaxosome-coupling protein TaxA -
OEC00_RS27895 (OEC00_27895) 16874..17221 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OEC00_RS27900 (OEC00_27900) 17218..17466 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
OEC00_RS27905 (OEC00_27905) 17771..18121 - 351 WP_000854259.1 hypothetical protein -
OEC00_RS27910 (OEC00_27910) 18212..18511 - 300 WP_000650309.1 hypothetical protein -
OEC00_RS27915 (OEC00_27915) 18965..19192 - 228 WP_000801440.1 hypothetical protein -
OEC00_RS27920 (OEC00_27920) 19179..19430 - 252 WP_001230707.1 hypothetical protein -
OEC00_RS27925 (OEC00_27925) 19427..19969 - 543 WP_001083906.1 hypothetical protein -
OEC00_RS27930 (OEC00_27930) 20074..20589 - 516 WP_001025395.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..30124 30124


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T260497 WP_000520549.1 NZ_CP107047:c17466-17218 [Klebsiella pneumoniae]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT260497 WP_000681613.1 NZ_CP107047:c17221-16874 [Klebsiella pneumoniae]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References