Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3850583..3851334 | Replicon | chromosome |
Accession | NZ_CP107043 | ||
Organism | Klebsiella pneumoniae strain KPTA-2108 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | OEC00_RS18815 | Protein ID | WP_014386536.1 |
Coordinates | 3850852..3851334 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | OEC00_RS18810 | Protein ID | WP_004902250.1 |
Coordinates | 3850583..3850861 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEC00_RS18785 (3846234) | 3846234..3846620 | - | 387 | WP_063102497.1 | bleomycin binding protein | - |
OEC00_RS18790 (3846814) | 3846814..3847517 | - | 704 | Protein_3667 | IS6 family transposase | - |
OEC00_RS18795 (3847585) | 3847585..3848883 | + | 1299 | Protein_3668 | Tn3-like element Tn3 family transposase | - |
OEC00_RS18800 (3849803) | 3849803..3850144 | + | 342 | WP_004902257.1 | hypothetical protein | - |
OEC00_RS18805 (3850252) | 3850252..3850464 | + | 213 | WP_004902255.1 | hypothetical protein | - |
OEC00_RS18810 (3850583) | 3850583..3850861 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
OEC00_RS18815 (3850852) | 3850852..3851334 | + | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
OEC00_RS18820 (3852369) | 3852369..3852908 | + | 540 | WP_004902239.1 | hypothetical protein | - |
OEC00_RS18825 (3853013) | 3853013..3853405 | + | 393 | WP_032442757.1 | hypothetical protein | - |
OEC00_RS18830 (3853506) | 3853506..3854261 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
OEC00_RS18835 (3854288) | 3854288..3854935 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | qnrB4 / blaDHA-1 / sul1 / blaTEM-1B / rmtB / tet(G) / mph(E) / msr(E) / armA | - | 3821989..3896069 | 74080 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T260487 WP_014386536.1 NZ_CP107043:3850852-3851334 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |