Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3645952..3646723 | Replicon | chromosome |
Accession | NZ_CP107043 | ||
Organism | Klebsiella pneumoniae strain KPTA-2108 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | OEC00_RS17760 | Protein ID | WP_186980539.1 |
Coordinates | 3646334..3646723 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OEC00_RS17755 | Protein ID | WP_186980561.1 |
Coordinates | 3645952..3646278 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEC00_RS17725 (3641809) | 3641809..3642897 | + | 1089 | WP_065523308.1 | patatin-like phospholipase family protein | - |
OEC00_RS17730 (3643033) | 3643033..3643191 | - | 159 | Protein_3458 | transposase | - |
OEC00_RS17735 (3643864) | 3643864..3644685 | + | 822 | WP_065523307.1 | DUF932 domain-containing protein | - |
OEC00_RS17740 (3644719) | 3644719..3645168 | + | 450 | WP_094545028.1 | antirestriction protein | - |
OEC00_RS17745 (3645180) | 3645180..3645659 | + | 480 | WP_186980535.1 | DNA repair protein RadC | - |
OEC00_RS17750 (3645673) | 3645673..3645894 | + | 222 | WP_186980537.1 | DUF987 domain-containing protein | - |
OEC00_RS17755 (3645952) | 3645952..3646278 | + | 327 | WP_186980561.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OEC00_RS17760 (3646334) | 3646334..3646723 | + | 390 | WP_186980539.1 | TA system toxin CbtA family protein | Toxin |
OEC00_RS17765 (3646810) | 3646810..3647649 | + | 840 | WP_186980541.1 | DUF4942 domain-containing protein | - |
OEC00_RS17770 (3647990) | 3647990..3649378 | - | 1389 | WP_032420562.1 | MFS transporter | - |
OEC00_RS17775 (3649508) | 3649508..3650437 | + | 930 | WP_048993420.1 | LysR family transcriptional regulator | - |
OEC00_RS17780 (3650801) | 3650801..3651604 | - | 804 | WP_263598130.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3614574..3646723 | 32149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14334.27 Da Isoelectric Point: 8.5682
>T260486 WP_186980539.1 NZ_CP107043:3646334-3646723 [Klebsiella pneumoniae]
MQTKSSPLMRAASSHPSPVGVWQTLLTSLLEHHYGLTLSDTPFSDEQVIQQHIEAGISLADALNFIVEKYELVRTDRQGF
SIREQSPFITPIDILRARKATGLMNLGTYKDVTAITKGQHQQANTSGKR
MQTKSSPLMRAASSHPSPVGVWQTLLTSLLEHHYGLTLSDTPFSDEQVIQQHIEAGISLADALNFIVEKYELVRTDRQGF
SIREQSPFITPIDILRARKATGLMNLGTYKDVTAITKGQHQQANTSGKR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|