Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3605037..3605694 | Replicon | chromosome |
Accession | NZ_CP107043 | ||
Organism | Klebsiella pneumoniae strain KPTA-2108 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OEC00_RS17560 | Protein ID | WP_002916310.1 |
Coordinates | 3605284..3605694 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OEC00_RS17555 | Protein ID | WP_002916312.1 |
Coordinates | 3605037..3605303 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEC00_RS17530 (3600193) | 3600193..3601626 | - | 1434 | WP_064152027.1 | 6-phospho-beta-glucosidase | - |
OEC00_RS17535 (3601745) | 3601745..3602473 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OEC00_RS17540 (3602523) | 3602523..3602834 | + | 312 | WP_064152028.1 | N(4)-acetylcytidine aminohydrolase | - |
OEC00_RS17545 (3602998) | 3602998..3603657 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
OEC00_RS17550 (3603808) | 3603808..3604791 | - | 984 | WP_064152029.1 | tRNA-modifying protein YgfZ | - |
OEC00_RS17555 (3605037) | 3605037..3605303 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OEC00_RS17560 (3605284) | 3605284..3605694 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OEC00_RS17565 (3605701) | 3605701..3606222 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
OEC00_RS17570 (3606323) | 3606323..3607219 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OEC00_RS17575 (3607242) | 3607242..3607955 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OEC00_RS17580 (3607961) | 3607961..3609694 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T260485 WP_002916310.1 NZ_CP107043:3605284-3605694 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |