Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2728529..2729154 | Replicon | chromosome |
| Accession | NZ_CP107043 | ||
| Organism | Klebsiella pneumoniae strain KPTA-2108 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | OEC00_RS13235 | Protein ID | WP_019705794.1 |
| Coordinates | 2728529..2728912 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | OEC00_RS13240 | Protein ID | WP_004150355.1 |
| Coordinates | 2728912..2729154 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEC00_RS13220 (2725895) | 2725895..2726797 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| OEC00_RS13225 (2726794) | 2726794..2727429 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OEC00_RS13230 (2727426) | 2727426..2728355 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| OEC00_RS13235 (2728529) | 2728529..2728912 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OEC00_RS13240 (2728912) | 2728912..2729154 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| OEC00_RS13245 (2729359) | 2729359..2730276 | + | 918 | WP_004146235.1 | alpha/beta hydrolase | - |
| OEC00_RS13250 (2730291) | 2730291..2731232 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| OEC00_RS13255 (2731277) | 2731277..2731714 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| OEC00_RS13260 (2731711) | 2731711..2732571 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| OEC00_RS13265 (2732565) | 2732565..2733164 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T260483 WP_019705794.1 NZ_CP107043:c2728912-2728529 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |