Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2230915..2231431 | Replicon | chromosome |
Accession | NZ_CP107043 | ||
Organism | Klebsiella pneumoniae strain KPTA-2108 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OEC00_RS10875 | Protein ID | WP_004178374.1 |
Coordinates | 2230915..2231199 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OEC00_RS10880 | Protein ID | WP_002886901.1 |
Coordinates | 2231189..2231431 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEC00_RS10850 (2226310) | 2226310..2226618 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
OEC00_RS10855 (2226703) | 2226703..2226876 | + | 174 | WP_032412860.1 | hypothetical protein | - |
OEC00_RS10860 (2226879) | 2226879..2227622 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OEC00_RS10865 (2227979) | 2227979..2230117 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OEC00_RS10870 (2230447) | 2230447..2230911 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OEC00_RS10875 (2230915) | 2230915..2231199 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEC00_RS10880 (2231189) | 2231189..2231431 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OEC00_RS10885 (2231509) | 2231509..2233419 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OEC00_RS10890 (2233442) | 2233442..2234596 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OEC00_RS10895 (2234663) | 2234663..2235403 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T260481 WP_004178374.1 NZ_CP107043:c2231199-2230915 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |