Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1492769..1493388 | Replicon | chromosome |
| Accession | NZ_CP107043 | ||
| Organism | Klebsiella pneumoniae strain KPTA-2108 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OEC00_RS07385 | Protein ID | WP_002892050.1 |
| Coordinates | 1493170..1493388 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OEC00_RS07380 | Protein ID | WP_002892066.1 |
| Coordinates | 1492769..1493143 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEC00_RS07370 (1487921) | 1487921..1489114 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OEC00_RS07375 (1489137) | 1489137..1492283 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OEC00_RS07380 (1492769) | 1492769..1493143 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OEC00_RS07385 (1493170) | 1493170..1493388 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OEC00_RS07390 (1493551) | 1493551..1494117 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OEC00_RS07395 (1494089) | 1494089..1494229 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OEC00_RS07400 (1494250) | 1494250..1494720 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OEC00_RS07405 (1494695) | 1494695..1496146 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
| OEC00_RS07410 (1496247) | 1496247..1496945 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OEC00_RS07415 (1496942) | 1496942..1497082 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OEC00_RS07420 (1497082) | 1497082..1497345 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260479 WP_002892050.1 NZ_CP107043:1493170-1493388 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT260479 WP_002892066.1 NZ_CP107043:1492769-1493143 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |