Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1492769..1493388 Replicon chromosome
Accession NZ_CP107043
Organism Klebsiella pneumoniae strain KPTA-2108

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OEC00_RS07385 Protein ID WP_002892050.1
Coordinates 1493170..1493388 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OEC00_RS07380 Protein ID WP_002892066.1
Coordinates 1492769..1493143 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEC00_RS07370 (1487921) 1487921..1489114 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OEC00_RS07375 (1489137) 1489137..1492283 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OEC00_RS07380 (1492769) 1492769..1493143 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OEC00_RS07385 (1493170) 1493170..1493388 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OEC00_RS07390 (1493551) 1493551..1494117 + 567 WP_002892030.1 maltose O-acetyltransferase -
OEC00_RS07395 (1494089) 1494089..1494229 - 141 WP_004147370.1 hypothetical protein -
OEC00_RS07400 (1494250) 1494250..1494720 + 471 WP_002892026.1 YlaC family protein -
OEC00_RS07405 (1494695) 1494695..1496146 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OEC00_RS07410 (1496247) 1496247..1496945 + 699 WP_002892021.1 GNAT family protein -
OEC00_RS07415 (1496942) 1496942..1497082 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OEC00_RS07420 (1497082) 1497082..1497345 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260479 WP_002892050.1 NZ_CP107043:1493170-1493388 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260479 WP_002892066.1 NZ_CP107043:1492769-1493143 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References