Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 162371..163994 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107041 | ||
Organism | Klebsiella oxytoca strain TYL-T1 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | NQA44_RS28400 | Protein ID | WP_263616043.1 |
Coordinates | 162669..163994 (+) | Length | 442 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | A0A5Z6V2D1 |
Locus tag | NQA44_RS28395 | Protein ID | WP_024136327.1 |
Coordinates | 162371..162664 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQA44_RS28365 (NQA44_28365) | 158243..159484 | + | 1242 | WP_001053338.1 | VWA domain-containing protein | - |
NQA44_RS28370 (NQA44_28370) | 159575..159706 | + | 132 | WP_000374059.1 | hypothetical protein | - |
NQA44_RS28375 (NQA44_28375) | 160047..160328 | - | 282 | WP_000077926.1 | hypothetical protein | - |
NQA44_RS28380 (NQA44_28380) | 160378..160569 | - | 192 | WP_000398480.1 | hypothetical protein | - |
NQA44_RS28385 (NQA44_28385) | 160661..161002 | - | 342 | WP_001151575.1 | hypothetical protein | - |
NQA44_RS28390 (NQA44_28390) | 161375..161767 | + | 393 | WP_000341066.1 | hypothetical protein | - |
NQA44_RS28395 (NQA44_28395) | 162371..162664 | + | 294 | WP_024136327.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NQA44_RS28400 (NQA44_28400) | 162669..163994 | + | 1326 | WP_263616043.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
NQA44_RS28405 (NQA44_28405) | 164055..164261 | + | 207 | WP_000134171.1 | hypothetical protein | - |
NQA44_RS28410 (NQA44_28410) | 164363..164773 | + | 411 | WP_000985911.1 | hypothetical protein | - |
NQA44_RS28415 (NQA44_28415) | 164786..165031 | + | 246 | Protein_164 | HNH endonuclease | - |
NQA44_RS28420 (NQA44_28420) | 165084..165788 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
NQA44_RS28425 (NQA44_28425) | 165835..166410 | - | 576 | WP_072740834.1 | recombinase family protein | - |
NQA44_RS28430 (NQA44_28430) | 166536..166886 | - | 351 | WP_000454193.1 | DUF3330 domain-containing protein | - |
NQA44_RS28435 (NQA44_28435) | 167089..168102 | - | 1014 | WP_000845048.1 | class 1 integron integrase IntI1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | cmlA1 / dfrA14 / ant(3'')-Ia / blaOXA-10 / qnrS1 / tet(A) / blaTEM-1B / aadA2 / sul3 / aac(3)-IVa / aph(4)-Ia / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / lnu(F) | - | 1..208719 | 208719 | |
- | inside | Integron | lnu(F) / cml / cmlA1 / ARR-3 / ant(3'')-Ia / blaOXA-10 / dfrA14 | - | 2..208508 | 208506 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 442 a.a. Molecular weight: 50309.23 Da Isoelectric Point: 6.1935
>T260477 WP_263616043.1 NZ_CP107041:162669-163994 [Klebsiella oxytoca]
MSRKQQRLVIWMNGIKVGYWEKSKGVDSLEYLPEWVADEQGRPLSLSLPFTPGNQVWRGNVVRDYFDNLLPDSEGIRRRL
AMRYKADSLEPFDLLTELGKDCVGAIQLLHDGDEPTDLYSVKYHPLTESEIAATLRNTTETLLPGRPEDNDDLRLSIAGA
QEKTALLWHEDRWCMPEGNTPTTHIFKLPLGLVGNMKADMSSSVENEWLCSVLLGQYGLPVARTQIAHFEDQKALVVERF
DRKWSGDGQWIIRLPQEDMCQALGVSPLRKYQADGGPGISEIMEVLSNSDRAERDKAQFFMTQIIFWMMAATDGHAKNFS
ISIGPQGRYHLTPNYDVLSAWPVIGHGNNQISWQKCKLAMAVRGSSNYYQIYRIQRRHWIRHGEITGLSKQQTEAMIEEI
IARTPGVIERVSGLLPDQFPQQLAESIFDGMRQQYRRLAEK
MSRKQQRLVIWMNGIKVGYWEKSKGVDSLEYLPEWVADEQGRPLSLSLPFTPGNQVWRGNVVRDYFDNLLPDSEGIRRRL
AMRYKADSLEPFDLLTELGKDCVGAIQLLHDGDEPTDLYSVKYHPLTESEIAATLRNTTETLLPGRPEDNDDLRLSIAGA
QEKTALLWHEDRWCMPEGNTPTTHIFKLPLGLVGNMKADMSSSVENEWLCSVLLGQYGLPVARTQIAHFEDQKALVVERF
DRKWSGDGQWIIRLPQEDMCQALGVSPLRKYQADGGPGISEIMEVLSNSDRAERDKAQFFMTQIIFWMMAATDGHAKNFS
ISIGPQGRYHLTPNYDVLSAWPVIGHGNNQISWQKCKLAMAVRGSSNYYQIYRIQRRHWIRHGEITGLSKQQTEAMIEEI
IARTPGVIERVSGLLPDQFPQQLAESIFDGMRQQYRRLAEK
Download Length: 1326 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|