Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 5173916..5174619 | Replicon | chromosome |
Accession | NZ_CP107040 | ||
Organism | Klebsiella oxytoca strain TYL-T1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NQA44_RS24150 | Protein ID | WP_049017155.1 |
Coordinates | 5173916..5174257 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NQA44_RS24155 | Protein ID | WP_196550622.1 |
Coordinates | 5174278..5174619 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQA44_RS24130 (NQA44_24130) | 5170160..5170954 | + | 795 | WP_196550621.1 | DNA/RNA non-specific endonuclease | - |
NQA44_RS24135 (NQA44_24135) | 5171243..5171566 | + | 324 | WP_023320260.1 | endoribonuclease SymE | - |
NQA44_RS24140 (NQA44_24140) | 5171713..5172147 | + | 435 | WP_023320259.1 | VOC family protein | - |
NQA44_RS24145 (NQA44_24145) | 5172650..5173657 | - | 1008 | WP_049017154.1 | restriction endonuclease | - |
NQA44_RS24150 (NQA44_24150) | 5173916..5174257 | - | 342 | WP_049017155.1 | TA system toxin CbtA family protein | Toxin |
NQA44_RS24155 (NQA44_24155) | 5174278..5174619 | - | 342 | WP_196550622.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NQA44_RS24160 (NQA44_24160) | 5174630..5175172 | - | 543 | WP_196550623.1 | DNA repair protein RadC | - |
NQA44_RS24165 (NQA44_24165) | 5175185..5175628 | - | 444 | WP_047365977.1 | antirestriction protein | - |
NQA44_RS24170 (NQA44_24170) | 5175659..5176480 | - | 822 | WP_049017158.1 | DUF932 domain-containing protein | - |
NQA44_RS24175 (NQA44_24175) | 5176601..5177074 | - | 474 | WP_049017159.1 | hypothetical protein | - |
NQA44_RS24180 (NQA44_24180) | 5177146..5177598 | - | 453 | WP_077258843.1 | hypothetical protein | - |
NQA44_RS24185 (NQA44_24185) | 5177634..5178350 | - | 717 | WP_048291793.1 | WYL domain-containing protein | - |
NQA44_RS24190 (NQA44_24190) | 5178594..5179469 | - | 876 | WP_048291792.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5171713..5190873 | 19160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12724.66 Da Isoelectric Point: 6.4514
>T260476 WP_049017155.1 NZ_CP107040:c5174257-5173916 [Klebsiella oxytoca]
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|