Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4650645..4651464 | Replicon | chromosome |
Accession | NZ_CP107040 | ||
Organism | Klebsiella oxytoca strain TYL-T1 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | NQA44_RS21820 | Protein ID | WP_004110819.1 |
Coordinates | 4651207..4651464 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | NQA44_RS21815 | Protein ID | WP_023320373.1 |
Coordinates | 4650645..4651196 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQA44_RS21785 (NQA44_21785) | 4646024..4646704 | + | 681 | WP_023320375.1 | nitroreductase | - |
NQA44_RS21790 (NQA44_21790) | 4646712..4647914 | - | 1203 | WP_032745597.1 | multidrug effflux MFS transporter | - |
NQA44_RS21795 (NQA44_21795) | 4648417..4648620 | - | 204 | Protein_4287 | VOC family protein | - |
NQA44_RS21800 (NQA44_21800) | 4648620..4648829 | - | 210 | WP_196089984.1 | hypothetical protein | - |
NQA44_RS21805 (NQA44_21805) | 4648999..4649763 | - | 765 | WP_224226441.1 | class I SAM-dependent methyltransferase | - |
NQA44_RS21810 (NQA44_21810) | 4650157..4650531 | - | 375 | Protein_4290 | class I SAM-dependent methyltransferase | - |
NQA44_RS21815 (NQA44_21815) | 4650645..4651196 | - | 552 | WP_023320373.1 | N-acetyltransferase | Antitoxin |
NQA44_RS21820 (NQA44_21820) | 4651207..4651464 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
NQA44_RS21825 (NQA44_21825) | 4652046..4653230 | + | 1185 | WP_004099225.1 | mannonate dehydratase | - |
NQA44_RS21830 (NQA44_21830) | 4653305..4654780 | + | 1476 | WP_004110817.1 | fructuronate reductase | - |
NQA44_RS21835 (NQA44_21835) | 4654916..4655692 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T260475 WP_004110819.1 NZ_CP107040:c4651464-4651207 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20138.98 Da Isoelectric Point: 6.8799
>AT260475 WP_023320373.1 NZ_CP107040:c4651196-4650645 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHAAYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|