Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4387559..4388178 | Replicon | chromosome |
Accession | NZ_CP107040 | ||
Organism | Klebsiella oxytoca strain TYL-T1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | NQA44_RS20570 | Protein ID | WP_004099646.1 |
Coordinates | 4387960..4388178 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NQA44_RS20565 | Protein ID | WP_004099648.1 |
Coordinates | 4387559..4387933 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQA44_RS20555 (NQA44_20555) | 4382715..4383908 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NQA44_RS20560 (NQA44_20560) | 4383931..4387077 | + | 3147 | WP_263615965.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NQA44_RS20565 (NQA44_20565) | 4387559..4387933 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
NQA44_RS20570 (NQA44_20570) | 4387960..4388178 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
NQA44_RS20575 (NQA44_20575) | 4388339..4388905 | + | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
NQA44_RS20580 (NQA44_20580) | 4388874..4389011 | - | 138 | WP_224226357.1 | hypothetical protein | - |
NQA44_RS20585 (NQA44_20585) | 4389042..4389512 | + | 471 | WP_004111038.1 | YlaC family protein | - |
NQA44_RS20590 (NQA44_20590) | 4389487..4390941 | - | 1455 | WP_023320459.1 | PLP-dependent aminotransferase family protein | - |
NQA44_RS20595 (NQA44_20595) | 4391043..4391741 | + | 699 | WP_004099639.1 | GNAT family protein | - |
NQA44_RS20600 (NQA44_20600) | 4391738..4391878 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NQA44_RS20605 (NQA44_20605) | 4391878..4392141 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T260474 WP_004099646.1 NZ_CP107040:4387960-4388178 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT260474 WP_004099648.1 NZ_CP107040:4387559-4387933 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|