Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1353814..1354586 | Replicon | chromosome |
| Accession | NZ_CP107040 | ||
| Organism | Klebsiella oxytoca strain TYL-T1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NQA44_RS06525 | Protein ID | WP_165569689.1 |
| Coordinates | 1353814..1354182 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NQA44_RS06530 | Protein ID | WP_032938030.1 |
| Coordinates | 1354227..1354586 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQA44_RS06500 (NQA44_06500) | 1349497..1349730 | - | 234 | WP_004132711.1 | hypothetical protein | - |
| NQA44_RS06505 (NQA44_06505) | 1350130..1350402 | + | 273 | WP_016247220.1 | hypothetical protein | - |
| NQA44_RS06510 (NQA44_06510) | 1350605..1351513 | + | 909 | WP_032938037.1 | kdo(2)-lipid IV(A) palmitoleoyltransferase | - |
| NQA44_RS06515 (NQA44_06515) | 1352287..1353276 | + | 990 | WP_047058004.1 | glycosyltransferase | - |
| NQA44_RS06520 (NQA44_06520) | 1353280..1353573 | + | 294 | WP_227010061.1 | hypothetical protein | - |
| NQA44_RS06525 (NQA44_06525) | 1353814..1354182 | - | 369 | WP_165569689.1 | TA system toxin CbtA family protein | Toxin |
| NQA44_RS06530 (NQA44_06530) | 1354227..1354586 | - | 360 | WP_032938030.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NQA44_RS06535 (NQA44_06535) | 1354609..1354830 | - | 222 | WP_032938028.1 | DUF987 domain-containing protein | - |
| NQA44_RS06540 (NQA44_06540) | 1354844..1355326 | - | 483 | WP_032938026.1 | DNA repair protein RadC | - |
| NQA44_RS06545 (NQA44_06545) | 1355567..1356046 | - | 480 | WP_075206252.1 | antirestriction protein | - |
| NQA44_RS06550 (NQA44_06550) | 1356126..1356947 | - | 822 | WP_039077576.1 | DUF932 domain-containing protein | - |
| NQA44_RS06555 (NQA44_06555) | 1357058..1357270 | - | 213 | WP_032938024.1 | hypothetical protein | - |
| NQA44_RS06560 (NQA44_06560) | 1357380..1357853 | - | 474 | WP_032938022.1 | hypothetical protein | - |
| NQA44_RS06565 (NQA44_06565) | 1357927..1358556 | - | 630 | WP_032938019.1 | hypothetical protein | - |
| NQA44_RS06570 (NQA44_06570) | 1358654..1359331 | - | 678 | WP_032938016.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1350605..1375802 | 25197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13644.59 Da Isoelectric Point: 9.7700
>T260469 WP_165569689.1 NZ_CP107040:c1354182-1353814 [Klebsiella oxytoca]
IQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGFSV
KEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
IQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGFSV
KEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
Download Length: 369 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13407.66 Da Isoelectric Point: 9.2466
>AT260469 WP_032938030.1 NZ_CP107040:c1354586-1354227 [Klebsiella oxytoca]
MQKATRVIKHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
MQKATRVIKHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|