Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2501776..2502412 | Replicon | chromosome |
Accession | NZ_CP107039 | ||
Organism | Bacillus subtilis strain 11060 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | ODQ18_RS13025 | Protein ID | WP_003156187.1 |
Coordinates | 2501776..2502126 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | ODQ18_RS13030 | Protein ID | WP_003225183.1 |
Coordinates | 2502131..2502412 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODQ18_RS12985 (2496820) | 2496820..2497419 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
ODQ18_RS12990 (2497419) | 2497419..2498207 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
ODQ18_RS12995 (2498173) | 2498173..2498655 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
ODQ18_RS13000 (2498652) | 2498652..2498981 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
ODQ18_RS13005 (2499043) | 2499043..2500050 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
ODQ18_RS13010 (2500062) | 2500062..2500463 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
ODQ18_RS13015 (2500467) | 2500467..2500832 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
ODQ18_RS13020 (2500837) | 2500837..2501661 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
ODQ18_RS13025 (2501776) | 2501776..2502126 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
ODQ18_RS13030 (2502131) | 2502131..2502412 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
ODQ18_RS13035 (2502528) | 2502528..2503697 | - | 1170 | WP_015252766.1 | alanine racemase | - |
ODQ18_RS13040 (2503811) | 2503811..2504827 | - | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
ODQ18_RS13045 (2504993) | 2504993..2505358 | - | 366 | WP_015252768.1 | holo-ACP synthase | - |
ODQ18_RS13050 (2505453) | 2505453..2506052 | + | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T260467 WP_003156187.1 NZ_CP107039:c2502126-2501776 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|