Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1700169..1701085 | Replicon | chromosome |
Accession | NZ_CP107039 | ||
Organism | Bacillus subtilis strain 11060 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | ODQ18_RS08765 | Protein ID | WP_003244695.1 |
Coordinates | 1700169..1700915 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | ODQ18_RS08770 | Protein ID | WP_003232646.1 |
Coordinates | 1700915..1701085 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODQ18_RS08740 (1695251) | 1695251..1695397 | - | 147 | WP_120363335.1 | hypothetical protein | - |
ODQ18_RS08745 (1695498) | 1695498..1696448 | - | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
ODQ18_RS08750 (1696836) | 1696836..1698152 | + | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
ODQ18_RS08755 (1698428) | 1698428..1699045 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
ODQ18_RS08760 (1699058) | 1699058..1700059 | + | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
ODQ18_RS08765 (1700169) | 1700169..1700915 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
ODQ18_RS08770 (1700915) | 1700915..1701085 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
ODQ18_RS08775 (1701171) | 1701171..1701308 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
ODQ18_RS08780 (1701345) | 1701345..1702238 | - | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
ODQ18_RS08785 (1702251) | 1702251..1702514 | - | 264 | WP_003232653.1 | phage holin | - |
ODQ18_RS08790 (1702527) | 1702527..1702796 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
ODQ18_RS08795 (1702849) | 1702849..1703688 | - | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
ODQ18_RS08800 (1703732) | 1703732..1703896 | - | 165 | WP_041850927.1 | XkdX family protein | - |
ODQ18_RS08805 (1703893) | 1703893..1704222 | - | 330 | WP_041850928.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T260466 WP_003244695.1 NZ_CP107039:1700169-1700915 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|