Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1790177..1790845 | Replicon | chromosome |
| Accession | NZ_CP107038 | ||
| Organism | Streptococcus pneumoniae strain BM6001 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | I0T4C6 |
| Locus tag | ODS73_RS09260 | Protein ID | WP_001132287.1 |
| Coordinates | 1790666..1790845 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | ODS73_RS09255 | Protein ID | WP_000961810.1 |
| Coordinates | 1790177..1790629 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODS73_RS09230 (ODS73_09220) | 1786069..1786812 | - | 744 | WP_284060535.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| ODS73_RS09235 (ODS73_09225) | 1786814..1787764 | - | 951 | WP_000451152.1 | 50S ribosomal protein L11 methyltransferase | - |
| ODS73_RS09240 (ODS73_09230) | 1787900..1788328 | - | 429 | WP_000418174.1 | NUDIX hydrolase | - |
| ODS73_RS09245 (ODS73_09235) | 1788309..1789397 | - | 1089 | WP_000719713.1 | site-2 protease family protein | - |
| ODS73_RS09250 (ODS73_09240) | 1789416..1789886 | - | 471 | WP_000257103.1 | DUF3013 family protein | - |
| ODS73_RS09255 (ODS73_09245) | 1790177..1790629 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| ODS73_RS09260 (ODS73_09250) | 1790666..1790845 | - | 180 | WP_001132287.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| ODS73_RS09265 (ODS73_09255) | 1790982..1791161 | - | 180 | WP_001048906.1 | hypothetical protein | - |
| ODS73_RS09270 (ODS73_09260) | 1791835..1793106 | + | 1272 | WP_001113213.1 | replication-associated recombination protein A | - |
| ODS73_RS09280 (ODS73_09270) | 1793652..1794971 | - | 1320 | WP_050095773.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6697.91 Da Isoelectric Point: 11.0174
>T260461 WP_001132287.1 NZ_CP107038:c1790845-1790666 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT260461 WP_000961810.1 NZ_CP107038:c1790629-1790177 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|