Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 621467..622104 | Replicon | chromosome |
Accession | NZ_CP107029 | ||
Organism | Pseudomonas aeruginosa strain PALA19 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PALA19_RS02900 | Protein ID | WP_019725766.1 |
Coordinates | 621467..621649 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PALA19_RS02905 | Protein ID | WP_019725767.1 |
Coordinates | 621682..622104 (+) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA19_RS02880 | 618447..618590 | + | 144 | WP_161566237.1 | hypothetical protein | - |
PALA19_RS02885 (PALA19_00577) | 618881..619216 | - | 336 | WP_155687260.1 | nuclease-related domain-containing protein | - |
PALA19_RS02890 (PALA19_00578) | 619345..620466 | - | 1122 | WP_003117952.1 | Fic family protein | - |
PALA19_RS02895 | 620725..620862 | - | 138 | WP_003113217.1 | hypothetical protein | - |
PALA19_RS02900 (PALA19_00579) | 621467..621649 | + | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PALA19_RS02905 (PALA19_00580) | 621682..622104 | + | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PALA19_RS02910 (PALA19_00582) | 622350..623321 | - | 972 | WP_033994831.1 | hypothetical protein | - |
PALA19_RS02915 (PALA19_00583) | 623306..623998 | - | 693 | WP_031633726.1 | hypothetical protein | - |
PALA19_RS02920 (PALA19_00584) | 623995..624537 | - | 543 | WP_025982284.1 | hypothetical protein | - |
PALA19_RS02925 (PALA19_00585) | 624534..625457 | - | 924 | WP_124136263.1 | hypothetical protein | - |
PALA19_RS02930 (PALA19_00586) | 625454..625930 | - | 477 | WP_109410360.1 | phage tail assembly chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 619345..674371 | 55026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T260452 WP_019725766.1 NZ_CP107029:621467-621649 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT260452 WP_019725767.1 NZ_CP107029:621682-622104 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|