Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 2584483..2585119 | Replicon | chromosome |
Accession | NZ_CP107027 | ||
Organism | Cytobacillus firmus strain M7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W7KPR3 |
Locus tag | OD459_RS13310 | Protein ID | WP_009336311.1 |
Coordinates | 2584483..2584833 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | W7L1R3 |
Locus tag | OD459_RS13315 | Protein ID | WP_035331931.1 |
Coordinates | 2584838..2585119 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OD459_RS13275 (OD459_13275) | 2579854..2580648 | - | 795 | WP_048008774.1 | RNA polymerase sigma factor SigB | - |
OD459_RS13280 (OD459_13280) | 2580626..2581099 | - | 474 | WP_009336304.1 | anti-sigma B factor RsbW | - |
OD459_RS13285 (OD459_13285) | 2581096..2581428 | - | 333 | WP_035331808.1 | anti-sigma factor antagonist | - |
OD459_RS13290 (OD459_13290) | 2581489..2582499 | - | 1011 | WP_263599118.1 | PP2C family protein-serine/threonine phosphatase | - |
OD459_RS13295 (OD459_13295) | 2582511..2582912 | - | 402 | WP_048008772.1 | anti-sigma regulatory factor | - |
OD459_RS13300 (OD459_13300) | 2582917..2583279 | - | 363 | WP_009336309.1 | STAS domain-containing protein | - |
OD459_RS13305 (OD459_13305) | 2583276..2584109 | - | 834 | WP_048008771.1 | RsbT co-antagonist protein RsbRA | - |
OD459_RS13310 (OD459_13310) | 2584483..2584833 | - | 351 | WP_009336311.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OD459_RS13315 (OD459_13315) | 2584838..2585119 | - | 282 | WP_035331931.1 | YlcI/YnfO family protein | Antitoxin |
OD459_RS13320 (OD459_13320) | 2585304..2586458 | - | 1155 | WP_258752060.1 | alanine racemase | - |
OD459_RS13325 (OD459_13325) | 2587257..2588270 | - | 1014 | WP_262177012.1 | outer membrane lipoprotein carrier protein LolA | - |
OD459_RS13330 (OD459_13330) | 2588413..2588766 | - | 354 | WP_048008767.1 | holo-ACP synthase | - |
OD459_RS13335 (OD459_13335) | 2588922..2589647 | + | 726 | WP_163144744.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T260450 WP_009336311.1 NZ_CP107027:c2584833-2584483 [Cytobacillus firmus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A169FD46 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7L1R3 |