Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 3758..4338 | Replicon | plasmid punamed1 |
| Accession | NZ_CP107018 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8J3DTL7 |
| Locus tag | OF890_RS29440 | Protein ID | WP_071177730.1 |
| Coordinates | 4024..4338 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | OF890_RS29435 | Protein ID | WP_000093040.1 |
| Coordinates | 3758..4036 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS29415 (OF890_29415) | 199..1686 | - | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
| OF890_RS29420 (OF890_29420) | 2331..2576 | + | 246 | WP_032440458.1 | hypothetical protein | - |
| OF890_RS29425 (OF890_29425) | 2850..3221 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
| OF890_RS29430 (OF890_29430) | 3218..3583 | + | 366 | WP_072354022.1 | TonB family protein | - |
| OF890_RS29435 (OF890_29435) | 3758..4036 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OF890_RS29440 (OF890_29440) | 4024..4338 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OF890_RS29445 (OF890_29445) | 4502..4930 | + | 429 | WP_001140599.1 | hypothetical protein | - |
| OF890_RS29450 (OF890_29450) | 4956..5135 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| OF890_RS29455 (OF890_29455) | 5162..5692 | - | 531 | WP_071177729.1 | hypothetical protein | - |
| OF890_RS29460 (OF890_29460) | 5699..6430 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
| OF890_RS29465 (OF890_29465) | 6430..8394 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..11970 | 11970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T260446 WP_071177730.1 NZ_CP107018:4024-4338 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|