Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 45535..46178 | Replicon | plasmid pKPC-K30821 |
Accession | NZ_CP107017 | ||
Organism | Klebsiella pneumoniae strain K30821 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OF890_RS29045 | Protein ID | WP_001044770.1 |
Coordinates | 45535..45951 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OF890_RS29050 | Protein ID | WP_001261282.1 |
Coordinates | 45948..46178 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF890_RS29015 (40773) | 40773..41210 | + | 438 | WP_113248398.1 | hypothetical protein | - |
OF890_RS29020 (41237) | 41237..41419 | - | 183 | WP_102765728.1 | Hha/YmoA family nucleoid-associated regulatory protein | - |
OF890_RS29025 (41643) | 41643..41897 | - | 255 | WP_224955282.1 | hypothetical protein | - |
OF890_RS29035 (42892) | 42892..43914 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OF890_RS29040 (43899) | 43899..45461 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OF890_RS29045 (45535) | 45535..45951 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OF890_RS29050 (45948) | 45948..46178 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OF890_RS29055 (46135) | 46135..46596 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OF890_RS29060 (46757) | 46757..47701 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OF890_RS29065 (47738) | 47738..48130 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OF890_RS29070 (48188) | 48188..48709 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OF890_RS29075 (48755) | 48755..48958 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OF890_RS29080 (48988) | 48988..49992 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OF890_RS29085 (50176) | 50176..50955 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..96126 | 96126 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260443 WP_001044770.1 NZ_CP107017:c45951-45535 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |