Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 45535..46178 Replicon plasmid pKPC-K30821
Accession NZ_CP107017
Organism Klebsiella pneumoniae strain K30821

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OF890_RS29045 Protein ID WP_001044770.1
Coordinates 45535..45951 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OF890_RS29050 Protein ID WP_001261282.1
Coordinates 45948..46178 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF890_RS29015 (40773) 40773..41210 + 438 WP_113248398.1 hypothetical protein -
OF890_RS29020 (41237) 41237..41419 - 183 WP_102765728.1 Hha/YmoA family nucleoid-associated regulatory protein -
OF890_RS29025 (41643) 41643..41897 - 255 WP_224955282.1 hypothetical protein -
OF890_RS29035 (42892) 42892..43914 - 1023 WP_000361404.1 helicase UvrD -
OF890_RS29040 (43899) 43899..45461 - 1563 WP_004206609.1 AAA family ATPase -
OF890_RS29045 (45535) 45535..45951 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OF890_RS29050 (45948) 45948..46178 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OF890_RS29055 (46135) 46135..46596 + 462 WP_014343465.1 hypothetical protein -
OF890_RS29060 (46757) 46757..47701 + 945 WP_011977810.1 hypothetical protein -
OF890_RS29065 (47738) 47738..48130 + 393 WP_011977811.1 hypothetical protein -
OF890_RS29070 (48188) 48188..48709 + 522 WP_013214008.1 hypothetical protein -
OF890_RS29075 (48755) 48755..48958 + 204 WP_011977813.1 hypothetical protein -
OF890_RS29080 (48988) 48988..49992 + 1005 WP_011977814.1 hypothetical protein -
OF890_RS29085 (50176) 50176..50955 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..96126 96126


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260443 WP_001044770.1 NZ_CP107017:c45951-45535 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260443 WP_001261282.1 NZ_CP107017:c46178-45948 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References