Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 75819..76729 Replicon plasmid pVi-K30821
Accession NZ_CP107015
Organism Klebsiella pneumoniae strain K30821

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OF890_RS27160 Protein ID WP_004026354.1
Coordinates 76259..76729 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OF890_RS27155 Protein ID WP_004026357.1
Coordinates 75819..76262 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF890_RS27125 (OF890_27125) 70837..71358 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
OF890_RS27130 (OF890_27130) 71355..72308 + 954 Protein_82 fec operon regulator FecR -
OF890_RS27135 (OF890_27135) 72395..74521 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
OF890_RS27140 (OF890_27140) 74596..74715 + 120 Protein_84 Fe3+-citrate ABC transporter substrate-binding protein -
OF890_RS27145 (OF890_27145) 74896..75117 + 222 WP_004213643.1 DUF2188 domain-containing protein -
OF890_RS27150 (OF890_27150) 75215..75718 + 504 Protein_86 DUF4113 domain-containing protein -
OF890_RS27155 (OF890_27155) 75819..76262 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OF890_RS27160 (OF890_27160) 76259..76729 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OF890_RS27165 (OF890_27165) 76878..77575 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OF890_RS27170 (OF890_27170) 77577..78026 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OF890_RS27175 (OF890_27175) 78043..78354 + 312 WP_011251282.1 hypothetical protein -
OF890_RS27180 (OF890_27180) 78368..78709 + 342 WP_011251281.1 hypothetical protein -
OF890_RS27185 (OF890_27185) 78769..79725 + 957 WP_011251280.1 DsbA family protein -
OF890_RS27190 (OF890_27190) 80150..80590 - 441 WP_011251275.1 hypothetical protein -
OF890_RS27195 (OF890_27195) 80596..81090 - 495 WP_011251274.1 hypothetical protein -
OF890_RS27200 (OF890_27200) 81099..81413 - 315 WP_011251273.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..237143 237143


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260434 WP_004026354.1 NZ_CP107015:76259-76729 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260434 WP_004026357.1 NZ_CP107015:75819-76262 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References