Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 22198..22868 Replicon plasmid pVi-K30821
Accession NZ_CP107015
Organism Klebsiella pneumoniae strain K30821

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OF890_RS26850 Protein ID WP_004213072.1
Coordinates 22425..22868 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OF890_RS26845 Protein ID WP_004213073.1
Coordinates 22198..22428 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF890_RS26820 (OF890_26820) 17383..18162 - 780 WP_004213560.1 site-specific integrase -
OF890_RS26825 (OF890_26825) 18159..18980 - 822 WP_004213562.1 hypothetical protein -
OF890_RS26830 (OF890_26830) 19952..20158 + 207 WP_004213077.1 hypothetical protein -
OF890_RS26835 (OF890_26835) 20148..20441 - 294 WP_004213076.1 hypothetical protein -
OF890_RS26840 (OF890_26840) 20457..21590 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
OF890_RS26845 (OF890_26845) 22198..22428 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OF890_RS26850 (OF890_26850) 22425..22868 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OF890_RS26855 (OF890_26855) 23017..23268 + 252 WP_186987481.1 hypothetical protein -
OF890_RS26860 (OF890_26860) 23291..23595 - 305 Protein_28 transposase -
OF890_RS26865 (OF890_26865) 24012..24647 + 636 Protein_29 mucoid phenotype regulator RmpA2 -
OF890_RS26870 (OF890_26870) 25165..25568 - 404 Protein_30 GAF domain-containing protein -
OF890_RS26875 (OF890_26875) 25659..26579 - 921 WP_004213934.1 DUF1471 domain-containing protein -
OF890_RS26880 (OF890_26880) 26628..27119 - 492 WP_011251327.1 DM13 domain-containing protein -
OF890_RS26885 (OF890_26885) 27182..27457 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..237143 237143


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260433 WP_004213072.1 NZ_CP107015:22425-22868 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260433 WP_004213073.1 NZ_CP107015:22198-22428 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References