Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 22198..22868 | Replicon | plasmid pVi-K30821 |
| Accession | NZ_CP107015 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | OF890_RS26850 | Protein ID | WP_004213072.1 |
| Coordinates | 22425..22868 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | OF890_RS26845 | Protein ID | WP_004213073.1 |
| Coordinates | 22198..22428 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS26820 (OF890_26820) | 17383..18162 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| OF890_RS26825 (OF890_26825) | 18159..18980 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| OF890_RS26830 (OF890_26830) | 19952..20158 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| OF890_RS26835 (OF890_26835) | 20148..20441 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| OF890_RS26840 (OF890_26840) | 20457..21590 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| OF890_RS26845 (OF890_26845) | 22198..22428 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OF890_RS26850 (OF890_26850) | 22425..22868 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OF890_RS26855 (OF890_26855) | 23017..23268 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| OF890_RS26860 (OF890_26860) | 23291..23595 | - | 305 | Protein_28 | transposase | - |
| OF890_RS26865 (OF890_26865) | 24012..24647 | + | 636 | Protein_29 | mucoid phenotype regulator RmpA2 | - |
| OF890_RS26870 (OF890_26870) | 25165..25568 | - | 404 | Protein_30 | GAF domain-containing protein | - |
| OF890_RS26875 (OF890_26875) | 25659..26579 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| OF890_RS26880 (OF890_26880) | 26628..27119 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| OF890_RS26885 (OF890_26885) | 27182..27457 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..237143 | 237143 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T260433 WP_004213072.1 NZ_CP107015:22425-22868 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|