Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4120156..4120775 Replicon chromosome
Accession NZ_CP107014
Organism Klebsiella pneumoniae strain K30821

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OF890_RS20580 Protein ID WP_002892050.1
Coordinates 4120557..4120775 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OF890_RS20575 Protein ID WP_002892066.1
Coordinates 4120156..4120530 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF890_RS20565 (OF890_20565) 4115308..4116501 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OF890_RS20570 (OF890_20570) 4116524..4119670 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OF890_RS20575 (OF890_20575) 4120156..4120530 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OF890_RS20580 (OF890_20580) 4120557..4120775 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OF890_RS20585 (OF890_20585) 4120934..4121500 + 567 WP_002892030.1 maltose O-acetyltransferase -
OF890_RS20590 (OF890_20590) 4121472..4121612 - 141 WP_004147370.1 hypothetical protein -
OF890_RS20595 (OF890_20595) 4121633..4122103 + 471 WP_002892026.1 YlaC family protein -
OF890_RS20600 (OF890_20600) 4122078..4123529 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OF890_RS20605 (OF890_20605) 4123630..4124328 + 699 WP_002892021.1 GNAT family protein -
OF890_RS20610 (OF890_20610) 4124325..4124465 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OF890_RS20615 (OF890_20615) 4124465..4124728 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260428 WP_002892050.1 NZ_CP107014:4120557-4120775 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260428 WP_002892066.1 NZ_CP107014:4120156-4120530 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References