Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4120156..4120775 | Replicon | chromosome |
Accession | NZ_CP107014 | ||
Organism | Klebsiella pneumoniae strain K30821 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OF890_RS20580 | Protein ID | WP_002892050.1 |
Coordinates | 4120557..4120775 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OF890_RS20575 | Protein ID | WP_002892066.1 |
Coordinates | 4120156..4120530 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF890_RS20565 (OF890_20565) | 4115308..4116501 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OF890_RS20570 (OF890_20570) | 4116524..4119670 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OF890_RS20575 (OF890_20575) | 4120156..4120530 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OF890_RS20580 (OF890_20580) | 4120557..4120775 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OF890_RS20585 (OF890_20585) | 4120934..4121500 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OF890_RS20590 (OF890_20590) | 4121472..4121612 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OF890_RS20595 (OF890_20595) | 4121633..4122103 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OF890_RS20600 (OF890_20600) | 4122078..4123529 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OF890_RS20605 (OF890_20605) | 4123630..4124328 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OF890_RS20610 (OF890_20610) | 4124325..4124465 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OF890_RS20615 (OF890_20615) | 4124465..4124728 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260428 WP_002892050.1 NZ_CP107014:4120557-4120775 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT260428 WP_002892066.1 NZ_CP107014:4120156-4120530 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |