Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelE-RHH |
| Location | 7068..7615 | Replicon | plasmid pSZB23-1 |
| Accession | NZ_CP107011 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | OF884_RS22625 | Protein ID | WP_244442846.1 |
| Coordinates | 7337..7615 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | E1QMW3 |
| Locus tag | OF884_RS22620 | Protein ID | WP_000079941.1 |
| Coordinates | 7068..7337 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS22595 (2509) | 2509..3717 | - | 1209 | WP_000198533.1 | IS91 family transposase | - |
| OF884_RS22600 (3698) | 3698..3970 | - | 273 | WP_000019163.1 | hypothetical protein | - |
| OF884_RS22605 (4185) | 4185..5000 | + | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| OF884_RS22610 (5087) | 5087..5329 | + | 243 | Protein_4 | phosphoglucosamine mutase | - |
| OF884_RS22615 (5565) | 5565..6710 | - | 1146 | Protein_5 | IS91-like element ISVsa3 family transposase | - |
| OF884_RS22620 (7068) | 7068..7337 | + | 270 | WP_000079941.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
| OF884_RS22625 (7337) | 7337..7615 | + | 279 | WP_244442846.1 | type II toxin-antitoxin system toxin YacB | Toxin |
| OF884_RS22630 (7655) | 7655..8503 | + | 849 | WP_021265674.1 | 3'-5' exonuclease | - |
| OF884_RS22635 (8620) | 8620..9093 | + | 474 | WP_001334658.1 | hypothetical protein | - |
| OF884_RS22640 (9570) | 9570..9836 | - | 267 | WP_000955263.1 | hypothetical protein | - |
| OF884_RS22645 (9836) | 9836..10330 | - | 495 | WP_001459505.1 | hypothetical protein | - |
| OF884_RS22650 (10386) | 10386..10988 | - | 603 | WP_000517695.1 | ProQ/FINO family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / blaCTX-M-14 | - | 1..97817 | 97817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10761.43 Da Isoelectric Point: 9.7617
>T260414 WP_244442846.1 NZ_CP107011:7337-7615 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MEIFWTMLASQDRKRIRKYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIRKYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Download Length: 90 a.a. Molecular weight: 10252.58 Da Isoelectric Point: 7.2057
>AT260414 WP_000079941.1 NZ_CP107011:7068-7337 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK
Download Length: 270 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|