Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4017482..4018032 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | OF884_RS19435 | Protein ID | WP_001199743.1 |
| Coordinates | 4017482..4017790 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | OF884_RS19440 | Protein ID | WP_000016244.1 |
| Coordinates | 4017793..4018032 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS19425 (4012901) | 4012901..4016416 | - | 3516 | WP_000342546.1 | AAA domain-containing protein | - |
| OF884_RS19430 (4016778) | 4016778..4017061 | - | 284 | Protein_3802 | Arm DNA-binding domain-containing protein | - |
| OF884_RS19435 (4017482) | 4017482..4017790 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| OF884_RS19440 (4017793) | 4017793..4018032 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| OF884_RS19445 (4018145) | 4018145..4018393 | - | 249 | WP_000168387.1 | ribbon-helix-helix domain-containing protein | - |
| OF884_RS19450 (4018584) | 4018584..4019015 | - | 432 | Protein_3806 | helix-turn-helix domain-containing protein | - |
| OF884_RS19460 (4019773) | 4019773..4020792 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| OF884_RS19465 (4020820) | 4020820..4021350 | - | 531 | WP_000896756.1 | gluconokinase | - |
| OF884_RS19470 (4021567) | 4021567..4022598 | + | 1032 | WP_000453341.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4018470..4018970 | 500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T260410 WP_001199743.1 NZ_CP107010:c4017790-4017482 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |