Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3975498..3976074 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | OF884_RS19260 | Protein ID | WP_001131963.1 |
| Coordinates | 3975787..3976074 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | OF884_RS19255 | Protein ID | WP_000063143.1 |
| Coordinates | 3975498..3975800 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS19240 (3972008) | 3972008..3974158 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
| OF884_RS19245 (3974253) | 3974253..3974456 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| OF884_RS19250 (3974467) | 3974467..3975423 | + | 957 | WP_000187838.1 | GTPase | - |
| OF884_RS19255 (3975498) | 3975498..3975800 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| OF884_RS19260 (3975787) | 3975787..3976074 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| OF884_RS19265 (3976343) | 3976343..3977257 | - | 915 | WP_000290513.1 | restriction endonuclease | - |
| OF884_RS19270 (3977455) | 3977455..3980964 | + | 3510 | WP_023210401.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T260409 WP_001131963.1 NZ_CP107010:c3976074-3975787 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT260409 WP_000063143.1 NZ_CP107010:c3975800-3975498 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|