Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3379464..3380084 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OF884_RS16515 | Protein ID | WP_001280991.1 |
| Coordinates | 3379866..3380084 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OF884_RS16510 | Protein ID | WP_000344807.1 |
| Coordinates | 3379464..3379838 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS16500 (3374603) | 3374603..3375796 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OF884_RS16505 (3375819) | 3375819..3378968 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| OF884_RS16510 (3379464) | 3379464..3379838 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OF884_RS16515 (3379866) | 3379866..3380084 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OF884_RS16520 (3380262) | 3380262..3380813 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
| OF884_RS16525 (3380931) | 3380931..3381401 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| OF884_RS16530 (3381457) | 3381457..3381597 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OF884_RS16535 (3381603) | 3381603..3381863 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OF884_RS16540 (3382088) | 3382088..3383638 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| OF884_RS16550 (3383869) | 3383869..3384258 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| OF884_RS16555 (3384291) | 3384291..3384860 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T260408 WP_001280991.1 NZ_CP107010:3379866-3380084 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT260408 WP_000344807.1 NZ_CP107010:3379464-3379838 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|