Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 988451..989265 Replicon chromosome
Accession NZ_CP107010
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23

Toxin (Protein)


Gene name TacT3 Uniprot ID M7RPS8
Locus tag OF884_RS04730 Protein ID WP_000971649.1
Coordinates 988451..988978 (-) Length 176 a.a.

Antitoxin (Protein)


Gene name TacA3 Uniprot ID M7S6I2
Locus tag OF884_RS04735 Protein ID WP_000855694.1
Coordinates 988975..989265 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF884_RS04700 (984751) 984751..985149 + 399 Protein_921 cytoplasmic protein -
OF884_RS04705 (985340) 985340..985579 + 240 Protein_922 hypothetical protein -
OF884_RS04710 (985736) 985736..986404 + 669 WP_000445915.1 hypothetical protein -
OF884_RS04715 (986431) 986431..986925 + 495 WP_000424947.1 hypothetical protein -
OF884_RS04720 (987169) 987169..987825 - 657 WP_000420452.1 protein-serine/threonine phosphatase -
OF884_RS04725 (988163) 988163..988378 + 216 Protein_926 IS5/IS1182 family transposase -
OF884_RS04730 (988451) 988451..988978 - 528 WP_000971649.1 GNAT family N-acetyltransferase Toxin
OF884_RS04735 (988975) 988975..989265 - 291 WP_000855694.1 DUF1778 domain-containing protein Antitoxin
OF884_RS04740 (989535) 989535..989724 - 190 Protein_929 IS3 family transposase -
OF884_RS04745 (989965) 989965..990291 + 327 WP_000393302.1 hypothetical protein -
OF884_RS04750 (990564) 990564..990911 - 348 WP_001669174.1 DUF1493 family protein -
OF884_RS04755 (990896) 990896..991345 - 450 WP_000381612.1 membrane protein -
OF884_RS04760 (991776) 991776..992219 - 444 WP_000715096.1 SPI-1 type III secretion system invasion lipoprotein InvH -
OF884_RS04765 (992676) 992676..993326 + 651 WP_001674874.1 type III secretion system transcriptional activator InvF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - invH / invF / invG / invE / invA / invB 987169..998639 11470
- flank IS/Tn - - 988238..988378 140


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Vibrio phage ICP1, Orf50

(1-95)


Sequences

Toxin        


Download         Length: 176 a.a.        Molecular weight: 19026.88 Da        Isoelectric Point: 9.3905

>T260402 WP_000971649.1 NZ_CP107010:c988978-988451 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Download         Length: 528 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10664.50 Da        Isoelectric Point: 6.3133

>AT260402 WP_000855694.1 NZ_CP107010:c989265-988975 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V5VVF5

Antitoxin

Source ID Structure
AlphaFold DB A0A3V8SJE7

References