Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 842693..843318 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OF884_RS04075 | Protein ID | WP_000911337.1 |
| Coordinates | 842920..843318 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3R8TS06 |
| Locus tag | OF884_RS04070 | Protein ID | WP_000557548.1 |
| Coordinates | 842693..842920 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS04040 (837738) | 837738..839255 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| OF884_RS04045 (839331) | 839331..839876 | - | 546 | WP_000133985.1 | isopentenyl-diphosphate Delta-isomerase | - |
| OF884_RS04050 (840141) | 840141..840899 | + | 759 | WP_000244330.1 | amidase activator ActS | - |
| OF884_RS04060 (841184) | 841184..841990 | - | 807 | WP_077905557.1 | DUF1460 domain-containing protein | - |
| OF884_RS04065 (842265) | 842265..842516 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| OF884_RS04070 (842693) | 842693..842920 | + | 228 | WP_000557548.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| OF884_RS04075 (842920) | 842920..843318 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OF884_RS04080 (844126) | 844126..844662 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| OF884_RS04085 (844709) | 844709..845341 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| OF884_RS04090 (846060) | 846060..846644 | + | 585 | WP_001244635.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 842265..851104 | 8839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T260401 WP_000911337.1 NZ_CP107010:842920-843318 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|