Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 255160..255809 | Replicon | chromosome |
Accession | NZ_CP107009 | ||
Organism | Halomonas sp. LR3S48 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OCT51_RS01160 | Protein ID | WP_263583899.1 |
Coordinates | 255160..255357 (+) | Length | 66 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OCT51_RS01165 | Protein ID | WP_263582090.1 |
Coordinates | 255396..255809 (+) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCT51_RS01145 (OCT51_01145) | 252121..252618 | + | 498 | WP_263582087.1 | contact-dependent growth inhibition system immunity protein | - |
OCT51_RS01150 (OCT51_01150) | 252823..254604 | + | 1782 | WP_263582088.1 | DUF637 domain-containing protein | - |
OCT51_RS01155 (OCT51_01155) | 254604..254972 | + | 369 | WP_263582089.1 | hypothetical protein | - |
OCT51_RS01160 (OCT51_01160) | 255160..255357 | + | 198 | WP_263583899.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OCT51_RS01165 (OCT51_01165) | 255396..255809 | + | 414 | WP_263582090.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OCT51_RS01170 (OCT51_01170) | 255889..257397 | - | 1509 | WP_263582091.1 | MFS transporter | - |
OCT51_RS01175 (OCT51_01175) | 257453..257911 | - | 459 | WP_263582092.1 | universal stress protein | - |
OCT51_RS01180 (OCT51_01180) | 257981..259612 | - | 1632 | WP_263582093.1 | antiporter | - |
OCT51_RS01185 (OCT51_01185) | 259897..260565 | - | 669 | WP_263582094.1 | two-component system response regulator NarL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 66 a.a. Molecular weight: 7486.64 Da Isoelectric Point: 10.7164
>T260396 WP_263583899.1 NZ_CP107009:255160-255357 [Halomonas sp. LR3S48]
MAWGYYNPKERGKEPEADGWTLDRVKGSHHHFRHPYKPGTITVPHPKKDLKKGLIQGIRKQAGLK
MAWGYYNPKERGKEPEADGWTLDRVKGSHHHFRHPYKPGTITVPHPKKDLKKGLIQGIRKQAGLK
Download Length: 198 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 14946.79 Da Isoelectric Point: 5.1469
>AT260396 WP_263582090.1 NZ_CP107009:255396-255809 [Halomonas sp. LR3S48]
MHYPIAIEVGDEQHAYGVVVPDLPGCFSAGDTFDGAIANAREAIEGHLESLAEHGDPIPTATAIQQHLENPDFAGWIWAA
VEIDMTPYLGKSHKINVTLPDLLIKRIDSTVAKHGDYKSRSGFLARAALHELERHAQ
MHYPIAIEVGDEQHAYGVVVPDLPGCFSAGDTFDGAIANAREAIEGHLESLAEHGDPIPTATAIQQHLENPDFAGWIWAA
VEIDMTPYLGKSHKINVTLPDLLIKRIDSTVAKHGDYKSRSGFLARAALHELERHAQ
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|