Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-relB/YoeB-RelB
Location 1466768..1467293 Replicon chromosome
Accession NZ_CP107007
Organism Halomonas sp. GD1P12

Toxin (Protein)


Gene name Txe Uniprot ID -
Locus tag OCT39_RS06835 Protein ID WP_244183129.1
Coordinates 1466768..1466992 (-) Length 75 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OCT39_RS06840 Protein ID WP_263586914.1
Coordinates 1467021..1467293 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCT39_RS06795 (OCT39_06795) 1462076..1462621 + 546 WP_263586906.1 hypothetical protein -
OCT39_RS06800 (OCT39_06800) 1462721..1463161 + 441 WP_263586907.1 YtoQ family protein -
OCT39_RS06805 (OCT39_06805) 1463617..1464093 + 477 WP_263586908.1 hypothetical protein -
OCT39_RS06810 (OCT39_06810) 1464095..1464856 + 762 WP_263586909.1 hypothetical protein -
OCT39_RS06815 (OCT39_06815) 1464955..1465230 + 276 WP_263586910.1 hypothetical protein -
OCT39_RS06820 (OCT39_06820) 1465246..1465494 + 249 WP_263586911.1 hypothetical protein -
OCT39_RS06825 (OCT39_06825) 1465567..1466046 + 480 WP_263586912.1 hypothetical protein -
OCT39_RS06830 (OCT39_06830) 1466185..1466382 + 198 WP_263586913.1 pyridoxamine 5'-phosphate oxidase family protein -
OCT39_RS06835 (OCT39_06835) 1466768..1466992 - 225 WP_244183129.1 Txe/YoeB family addiction module toxin Toxin
OCT39_RS06840 (OCT39_06840) 1467021..1467293 - 273 WP_263586914.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OCT39_RS06845 (OCT39_06845) 1467442..1467840 + 399 WP_263586915.1 GFA family protein -
OCT39_RS06850 (OCT39_06850) 1467927..1468240 + 314 Protein_1328 transcription termination factor Rho -
OCT39_RS06855 (OCT39_06855) 1468369..1468965 + 597 WP_263586916.1 hypothetical protein -
OCT39_RS06860 (OCT39_06860) 1469044..1469643 + 600 WP_263586917.1 hypothetical protein -
OCT39_RS06865 (OCT39_06865) 1469982..1470935 + 954 WP_263586918.1 transcription termination factor Rho -
OCT39_RS06870 (OCT39_06870) 1471062..1472258 - 1197 WP_263586919.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1464095..1479077 14982


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-71)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 75 a.a.        Molecular weight: 8632.97 Da        Isoelectric Point: 10.1014

>T260394 WP_244183129.1 NZ_CP107007:c1466992-1466768 [Halomonas sp. GD1P12]
MREKDKKLHKALCKLLKEMLRSDDPSTGIGKPEPLKHNLSGLWSRRISQKDRLIYRFDDTSIYVFAIGGHYDQS

Download         Length: 225 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10377.58 Da        Isoelectric Point: 4.6486

>AT260394 WP_263586914.1 NZ_CP107007:c1467293-1467021 [Halomonas sp. GD1P12]
MDIISVNKFRDNLKSLVEQVVNNHEPLKVTRRAGEAFVIMSAEDWEREQETLHVLQNRDLMQQIATSLETHSRGQGYTPN
DEQLNEITGI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References