Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 374704..375314 | Replicon | chromosome |
Accession | NZ_CP107007 | ||
Organism | Halomonas sp. GD1P12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OCT39_RS01820 | Protein ID | WP_263586003.1 |
Coordinates | 374704..374886 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OCT39_RS01825 | Protein ID | WP_263586004.1 |
Coordinates | 374910..375314 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCT39_RS01800 (OCT39_01800) | 369857..370015 | - | 159 | WP_263585999.1 | DUF1127 domain-containing protein | - |
OCT39_RS01805 (OCT39_01805) | 370172..371602 | + | 1431 | WP_263586000.1 | PLP-dependent aminotransferase family protein | - |
OCT39_RS01810 (OCT39_01810) | 371770..372540 | + | 771 | WP_263586001.1 | hypothetical protein | - |
OCT39_RS01815 (OCT39_01815) | 372788..373093 | - | 306 | WP_263586002.1 | hypothetical protein | - |
OCT39_RS01820 (OCT39_01820) | 374704..374886 | + | 183 | WP_263586003.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OCT39_RS01825 (OCT39_01825) | 374910..375314 | + | 405 | WP_263586004.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OCT39_RS01830 (OCT39_01830) | 375555..378230 | + | 2676 | WP_263586005.1 | CRISPR-associated helicase Cas3' | - |
OCT39_RS01835 (OCT39_01835) | 378314..380035 | + | 1722 | WP_263586006.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6724.84 Da Isoelectric Point: 10.7304
>T260392 WP_263586003.1 NZ_CP107007:374704-374886 [Halomonas sp. GD1P12]
VKSRELIKEMEADGWYLDRVSGSHHVFKHSTKPGSVPVPHPKKDLPKGTIHSIRKLAGLK
VKSRELIKEMEADGWYLDRVSGSHHVFKHSTKPGSVPVPHPKKDLPKGTIHSIRKLAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.69 Da Isoelectric Point: 4.9268
>AT260392 WP_263586004.1 NZ_CP107007:374910-375314 [Halomonas sp. GD1P12]
MQYPIAIEWGDENTATGIVIPDIPGAVTAGDTTEHAYEMAVEVAHIQLEELANDNKDIPMPRSIAEHRRNPQFEGYGWGI
IDIDITPYLGKTEKVNVTLPGHVIRQIDKYVTTHGIKSRSAFIASAALEKLTHA
MQYPIAIEWGDENTATGIVIPDIPGAVTAGDTTEHAYEMAVEVAHIQLEELANDNKDIPMPRSIAEHRRNPQFEGYGWGI
IDIDITPYLGKTEKVNVTLPGHVIRQIDKYVTTHGIKSRSAFIASAALEKLTHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|