Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4032571..4033385 | Replicon | chromosome |
Accession | NZ_CP107005 | ||
Organism | Escherichia coli strain SY22A1 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | OFB12_RS19835 | Protein ID | WP_001054376.1 |
Coordinates | 4032571..4032828 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | OFB12_RS19840 | Protein ID | WP_001309181.1 |
Coordinates | 4032840..4033385 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFB12_RS19810 (4027859) | 4027859..4028965 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
OFB12_RS19815 (4029030) | 4029030..4030010 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
OFB12_RS19820 (4030120) | 4030120..4030325 | + | 206 | Protein_3873 | HNH endonuclease | - |
OFB12_RS19825 (4030593) | 4030593..4031833 | - | 1241 | Protein_3874 | helicase YjhR | - |
OFB12_RS19830 (4031949) | 4031949..4032080 | + | 132 | WP_001309182.1 | hypothetical protein | - |
OFB12_RS19835 (4032571) | 4032571..4032828 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
OFB12_RS19840 (4032840) | 4032840..4033385 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
OFB12_RS19845 (4033441) | 4033441..4034187 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
OFB12_RS19850 (4034356) | 4034356..4034574 | + | 219 | Protein_3879 | hypothetical protein | - |
OFB12_RS19855 (4034612) | 4034612..4034728 | + | 117 | Protein_3880 | VOC family protein | - |
OFB12_RS19860 (4034973) | 4034973..4036094 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
OFB12_RS19865 (4036091) | 4036091..4036369 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
OFB12_RS19870 (4036381) | 4036381..4037694 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4017768..4041609 | 23841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T260389 WP_001054376.1 NZ_CP107005:4032571-4032828 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT260389 WP_001309181.1 NZ_CP107005:4032840-4033385 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|