Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2381775..2382413 | Replicon | chromosome |
Accession | NZ_CP107004 | ||
Organism | Escherichia coli strain SY22A3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OFB07_RS11625 | Protein ID | WP_000813794.1 |
Coordinates | 2382237..2382413 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OFB07_RS11620 | Protein ID | WP_001270286.1 |
Coordinates | 2381775..2382191 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFB07_RS11600 (2376927) | 2376927..2377868 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
OFB07_RS11605 (2377869) | 2377869..2378882 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OFB07_RS11610 (2378900) | 2378900..2380045 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
OFB07_RS11615 (2380290) | 2380290..2381696 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OFB07_RS11620 (2381775) | 2381775..2382191 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OFB07_RS11625 (2382237) | 2382237..2382413 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OFB07_RS11630 (2382635) | 2382635..2382865 | + | 231 | WP_000494244.1 | YncJ family protein | - |
OFB07_RS11635 (2382957) | 2382957..2384918 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OFB07_RS11640 (2384991) | 2384991..2385527 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OFB07_RS11645 (2385580) | 2385580..2386794 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T260361 WP_000813794.1 NZ_CP107004:c2382413-2382237 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT260361 WP_001270286.1 NZ_CP107004:c2382191-2381775 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|