Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 977077..977660 | Replicon | chromosome |
Accession | NZ_CP107003 | ||
Organism | Escherichia coli strain SY22B1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | OFB13_RS04735 | Protein ID | WP_000254738.1 |
Coordinates | 977325..977660 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OFB13_RS04730 | Protein ID | WP_000581937.1 |
Coordinates | 977077..977325 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFB13_RS04710 (972080) | 972080..973381 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
OFB13_RS04715 (973429) | 973429..973689 | + | 261 | Protein_923 | GTP diphosphokinase | - |
OFB13_RS04720 (973780) | 973780..975008 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
OFB13_RS04725 (975020) | 975020..976999 | + | 1980 | Protein_925 | GTP diphosphokinase | - |
OFB13_RS04730 (977077) | 977077..977325 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OFB13_RS04735 (977325) | 977325..977660 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
OFB13_RS04740 (977731) | 977731..978522 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OFB13_RS04745 (978750) | 978750..980387 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OFB13_RS04750 (980475) | 980475..981773 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T260327 WP_000254738.1 NZ_CP107003:977325-977660 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|