Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3742983..3743662 Replicon chromosome
Accession NZ_CP107002
Organism Escherichia coli strain SY22C3

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag OFB02_RS18420 Protein ID WP_000854672.1
Coordinates 3743321..3743662 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag OFB02_RS18415 Protein ID WP_000070395.1
Coordinates 3742983..3743300 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFB02_RS18365 (3738030) 3738030..3738893 + 864 WP_001065553.1 GTPase family protein -
OFB02_RS18370 (3738985) 3738985..3739806 + 822 WP_000197389.1 DUF932 domain-containing protein -
OFB02_RS18375 (3740023) 3740023..3740214 + 192 Protein_3595 DeoR family transcriptional regulator -
OFB02_RS18380 (3740210) 3740210..3740437 + 228 WP_001548158.1 protein YpjK -
OFB02_RS18385 (3740437) 3740437..3740880 + 444 WP_000824223.1 lipoprotein YafY -
OFB02_RS18390 (3740903) 3740903..3741370 + 468 WP_001547765.1 protein YkfB -
OFB02_RS18395 (3741447) 3741447..3741686 + 240 WP_000194654.1 DUF905 family protein -
OFB02_RS18400 (3741784) 3741784..3742242 + 459 WP_000211838.1 antirestriction protein -
OFB02_RS18405 (3742258) 3742258..3742734 + 477 WP_000811693.1 RadC family protein -
OFB02_RS18410 (3742743) 3742743..3742964 + 222 WP_000691994.1 DUF987 domain-containing protein -
OFB02_RS18415 (3742983) 3742983..3743300 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
OFB02_RS18420 (3743321) 3743321..3743662 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
OFB02_RS18430 (3744234) 3744234..3745487 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
OFB02_RS18435 (3745499) 3745499..3746602 - 1104 WP_001285288.1 glutamate 5-kinase -
OFB02_RS18440 (3746890) 3746890..3747945 + 1056 WP_000749863.1 phosphoporin PhoE -
OFB02_RS18445 (3747984) 3747984..3748385 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T260317 WP_000854672.1 NZ_CP107002:3743321-3743662 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT260317 WP_000070395.1 NZ_CP107002:3742983-3743300 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References