Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3742983..3743662 | Replicon | chromosome |
| Accession | NZ_CP106999 | ||
| Organism | Escherichia coli strain SY22A4 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | OFB05_RS18420 | Protein ID | WP_000854672.1 |
| Coordinates | 3743321..3743662 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | OFB05_RS18415 | Protein ID | WP_000070395.1 |
| Coordinates | 3742983..3743300 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFB05_RS18365 (3738030) | 3738030..3738893 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| OFB05_RS18370 (3738985) | 3738985..3739806 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| OFB05_RS18375 (3740023) | 3740023..3740214 | + | 192 | Protein_3595 | DeoR family transcriptional regulator | - |
| OFB05_RS18380 (3740210) | 3740210..3740437 | + | 228 | WP_001548158.1 | protein YpjK | - |
| OFB05_RS18385 (3740437) | 3740437..3740880 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| OFB05_RS18390 (3740903) | 3740903..3741370 | + | 468 | WP_001547765.1 | protein YkfB | - |
| OFB05_RS18395 (3741447) | 3741447..3741686 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| OFB05_RS18400 (3741784) | 3741784..3742242 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| OFB05_RS18405 (3742258) | 3742258..3742734 | + | 477 | WP_000811693.1 | RadC family protein | - |
| OFB05_RS18410 (3742743) | 3742743..3742964 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| OFB05_RS18415 (3742983) | 3742983..3743300 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| OFB05_RS18420 (3743321) | 3743321..3743662 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| OFB05_RS18430 (3744234) | 3744234..3745487 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| OFB05_RS18435 (3745499) | 3745499..3746602 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| OFB05_RS18440 (3746890) | 3746890..3747945 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| OFB05_RS18445 (3747984) | 3747984..3748385 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T260248 WP_000854672.1 NZ_CP106999:3743321-3743662 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|