Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1812005..1812836 | Replicon | chromosome |
Accession | NZ_CP106999 | ||
Organism | Escherichia coli strain SY22A4 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | OFB05_RS08710 | Protein ID | WP_000854814.1 |
Coordinates | 1812005..1812379 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | OFB05_RS08715 | Protein ID | WP_001285584.1 |
Coordinates | 1812468..1812836 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFB05_RS08670 (1807401) | 1807401..1808567 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
OFB05_RS08675 (1808686) | 1808686..1809159 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
OFB05_RS08680 (1809357) | 1809357..1810415 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
OFB05_RS08685 (1810587) | 1810587..1810916 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
OFB05_RS08690 (1811017) | 1811017..1811151 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
OFB05_RS08695 (1811271) | 1811271..1811399 | + | 129 | Protein_1699 | transposase domain-containing protein | - |
OFB05_RS08700 (1811688) | 1811688..1811768 | - | 81 | Protein_1700 | hypothetical protein | - |
OFB05_RS08705 (1811814) | 1811814..1812008 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
OFB05_RS08710 (1812005) | 1812005..1812379 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
OFB05_RS08715 (1812468) | 1812468..1812836 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
OFB05_RS08720 (1812910) | 1812910..1813131 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
OFB05_RS08725 (1813194) | 1813194..1813640 | - | 447 | WP_000187523.1 | RadC family protein | - |
OFB05_RS08730 (1813637) | 1813637..1815169 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T260239 WP_000854814.1 NZ_CP106999:c1812379-1812005 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT260239 WP_001285584.1 NZ_CP106999:c1812836-1812468 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |