Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3561055..3561673 | Replicon | chromosome |
| Accession | NZ_CP106996 | ||
| Organism | Escherichia coli strain SY22D8 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | OFB06_RS17455 | Protein ID | WP_001290581.1 |
| Coordinates | 3561455..3561673 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | OFB06_RS17450 | Protein ID | WP_000344800.1 |
| Coordinates | 3561055..3561429 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFB06_RS17440 (3556144) | 3556144..3557337 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OFB06_RS17445 (3557360) | 3557360..3560509 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| OFB06_RS17450 (3561055) | 3561055..3561429 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| OFB06_RS17455 (3561455) | 3561455..3561673 | + | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
| OFB06_RS17460 (3561845) | 3561845..3562396 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| OFB06_RS17465 (3562512) | 3562512..3562982 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| OFB06_RS17470 (3563146) | 3563146..3564696 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| OFB06_RS17475 (3564738) | 3564738..3565091 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| OFB06_RS17485 (3565470) | 3565470..3565781 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| OFB06_RS17490 (3565812) | 3565812..3566384 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T260178 WP_001290581.1 NZ_CP106996:3561455-3561673 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT260178 WP_000344800.1 NZ_CP106996:3561055-3561429 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|