Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 5371207..5371842 | Replicon | chromosome |
Accession | NZ_CP106992 | ||
Organism | Paenibacillus thiaminolyticus strain SY20 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NDS46_RS24425 | Protein ID | WP_087444735.1 |
Coordinates | 5371207..5371557 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2W4HCL7 |
Locus tag | NDS46_RS24430 | Protein ID | WP_040731899.1 |
Coordinates | 5371561..5371842 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDS46_RS24420 (NDS46_24450) | 5368219..5370690 | + | 2472 | WP_272046762.1 | M60 family metallopeptidase | - |
NDS46_RS24425 (NDS46_24455) | 5371207..5371557 | - | 351 | WP_087444735.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NDS46_RS24430 (NDS46_24460) | 5371561..5371842 | - | 282 | WP_040731899.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NDS46_RS24435 (NDS46_24465) | 5372093..5373286 | - | 1194 | WP_272046763.1 | alanine racemase | - |
NDS46_RS24440 (NDS46_24470) | 5373528..5374646 | - | 1119 | WP_272046764.1 | DUF4367 domain-containing protein | - |
NDS46_RS24445 (NDS46_24475) | 5374963..5375214 | - | 252 | WP_272046765.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12862.87 Da Isoelectric Point: 5.6312
>T260115 WP_087444735.1 NZ_CP106992:c5371557-5371207 [Paenibacillus thiaminolyticus]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDGLLISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDGLLISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|