Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1670388..1671067 | Replicon | chromosome |
| Accession | NZ_CP106988 | ||
| Organism | Acinetobacter baumannii strain NY13623 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7Z1VKH9 |
| Locus tag | OC371_RS08175 | Protein ID | WP_000838148.1 |
| Coordinates | 1670388..1670570 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | OC371_RS08180 | Protein ID | WP_000966688.1 |
| Coordinates | 1670663..1671067 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC371_RS08135 (OC371_08135) | 1665599..1665967 | + | 369 | WP_002019566.1 | hypothetical protein | - |
| OC371_RS08140 (OC371_08140) | 1665976..1666383 | + | 408 | WP_000247950.1 | hypothetical protein | - |
| OC371_RS08145 (OC371_08145) | 1666355..1666723 | + | 369 | WP_000539750.1 | hypothetical protein | - |
| OC371_RS08150 (OC371_08150) | 1666725..1667123 | + | 399 | WP_001251875.1 | phage tail terminator-like protein | - |
| OC371_RS08155 (OC371_08155) | 1667192..1667542 | + | 351 | WP_000065011.1 | hypothetical protein | - |
| OC371_RS08160 (OC371_08160) | 1667542..1668507 | + | 966 | WP_000002429.1 | hypothetical protein | - |
| OC371_RS08165 (OC371_08165) | 1668560..1669477 | + | 918 | WP_000094259.1 | phage tail tube protein | - |
| OC371_RS08170 (OC371_08170) | 1669547..1670062 | + | 516 | WP_001185594.1 | hypothetical protein | - |
| OC371_RS08175 (OC371_08175) | 1670388..1670570 | + | 183 | WP_000838148.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OC371_RS08180 (OC371_08180) | 1670663..1671067 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OC371_RS08185 (OC371_08185) | 1671167..1671676 | + | 510 | WP_000734512.1 | hypothetical protein | - |
| OC371_RS08190 (OC371_08190) | 1671877..1672809 | - | 933 | WP_001043692.1 | IS5-like element ISAba13 family transposase | - |
| OC371_RS08195 (OC371_08195) | 1673114..1674760 | + | 1647 | WP_003383679.1 | phosphoethanolamine--lipid A transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | blaOXA-23 | - | 1632468..1686990 | 54522 | |
| - | flank | IS/Tn | - | - | 1671877..1672809 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6677.82 Da Isoelectric Point: 10.5523
>T260112 WP_000838148.1 NZ_CP106988:1670388-1670570 [Acinetobacter baumannii]
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT260112 WP_000966688.1 NZ_CP106988:1670663-1671067 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z1VKH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |