Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 3195836..3196814 | Replicon | chromosome |
| Accession | NZ_CP106987 | ||
| Organism | Bacillus cereus strain IBA1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | OF864_RS16350 | Protein ID | WP_000624977.1 |
| Coordinates | 3195836..3196573 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | OF864_RS16355 | Protein ID | WP_000237818.1 |
| Coordinates | 3196686..3196814 (+) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF864_RS16325 (OF864_16330) | 3191452..3191859 | + | 408 | WP_000063589.1 | VOC family protein | - |
| OF864_RS16330 (OF864_16335) | 3191872..3192261 | + | 390 | Protein_3141 | SAM-dependent methyltransferase | - |
| OF864_RS16335 (OF864_16340) | 3192419..3194104 | - | 1686 | WP_033689678.1 | alpha-keto acid decarboxylase family protein | - |
| OF864_RS16340 (OF864_16345) | 3194212..3194694 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OF864_RS16345 (OF864_16350) | 3194861..3195598 | + | 738 | WP_000594150.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| OF864_RS16350 (OF864_16355) | 3195836..3196573 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| OF864_RS16355 (OF864_16360) | 3196686..3196814 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| OF864_RS16360 (OF864_16365) | 3196887..3197063 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| OF864_RS16365 (OF864_16370) | 3197082..3197471 | - | 390 | WP_000713866.1 | YxeA family protein | - |
| OF864_RS16370 (OF864_16375) | 3197683..3199152 | + | 1470 | WP_283502302.1 | beta-Ala-His dipeptidase | - |
| OF864_RS16375 (OF864_16380) | 3199398..3200207 | + | 810 | WP_044584465.1 | papain-like cysteine protease family protein | - |
| OF864_RS16380 (OF864_16385) | 3200233..3200835 | + | 603 | WP_000517260.1 | hypothetical protein | - |
| OF864_RS16385 (OF864_16390) | 3201076..3201327 | - | 252 | WP_030025648.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T260110 WP_000624977.1 NZ_CP106987:3195836-3196573 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|